30 Minute Chickpea & Tomato Coconut Curry Soup
30-MINUTE MEALS! Get the email series now
Flavest

30 Minute Chickpea and Tomato Coconut Curry Soup

5 from 1 vote
1 Comments
Maria
By: MariaUpdated: May 6, 2026
This post may contain affiliate links. Please read our disclosure policy.

A cozy, pantry friendly chickpea and tomato coconut curry soup ready in 30 minutes. Vegan, gluten free, and full of warming curry flavor.

30 Minute Chickpea and Tomato Coconut Curry Soup

This 30 Minute Chickpea and Tomato Coconut Curry Soup is my go to weeknight comfort bowl when I want something fast nourishing and deeply satisfying. I first landed on this combination during a rainy spring when my fridge was low and my pantry was full, and the flavors came together so effortlessly that I tucked the method into regular rotation. The texture is creamy from full fat coconut milk with bright tomatoes and tender chickpeas offering a pleasant chew. Each spoonful is warm from curry and gently brightened by lime which keeps it lively rather than heavy.

What makes this one special is how little fuss it needs yet how rewarding the result feels. On nights when everyone is tired this soup helps the whole household pause and enjoy something wholesome without a long list of steps. I often double the batch for leftovers because it tastes even better the next day as the spices continue to bloom. For cooks who care about dietary restrictions it checks many boxes. It is naturally plant based, gluten free and uses mostly pantry staples that are easy to swap. Below I walk through exact steps shopping tips and sensible swaps so you can make a bowl that feels homemade and elegant in under 30 minutes.

Why You'll Love This Recipe

  • This bowl is ready in 30 minutes making it perfect for busy weeknights when you want comfort fast.
  • It uses pantry staples like canned chickpeas diced tomatoes and coconut milk so you can make it without a special shopping trip.
  • The texture is both creamy and chunk forward because full fat coconut milk adds silk while chickpeas hold their shape.
  • It is vegan and gluten free by default which makes it easy to serve to guests with common dietary needs.
  • Make ahead friendly and freezer friendly which makes it ideal for meal prep for the week.
  • The aromatics of onion garlic and curry powder develop quickly for big flavor with minimal effort.

I first served this to friends who expected a light soup and walked away full and surprised by how layered the flavor was. My family asks for it at least once a month and it has become our simple celebration dish when time is short. I enjoy adding roasted cashews for textural contrast and a wedge of lime at the table so everyone can tune the brightness to taste.

Ingredients

  • Avocado oil 2 tablespoons Use a neutral oil like avocado or light olive oil for a high smoke point. Avocado oil gives a clean background flavor and tolerates the sauté without burning.
  • Yellow onion 1 medium diced small A sweet yellow onion becomes translucent and adds natural sweetness. Dice fine so it softens evenly in five to six minutes.
  • Garlic 4 cloves thinly sliced Fresh sliced garlic releases more aroma than minced so watch it to avoid browning.
  • Salt 1 teaspoon Start with this baseline and finish with more to taste after the coconut milk joins the pot.
  • Curry powder 1 tablespoon Select a medium strength blend from a trusted brand. I like a balance of coriander cumin and turmeric for color and warmth.
  • Crushed dried chilies pinch Optional Add to taste or leave out for a milder bowl. A pinch gives a quietly warm finish.
  • Diced tomatoes 1 14.5 ounce can Petite diced tomatoes work well. Fire roasted adds a subtle char depth if you can find them.
  • Chickpeas 2 15.5 ounce cans drained and rinsed Chickpeas are the protein here and hold together so you get a satisfying bite in every spoonful.
  • Full fat coconut milk 1 13.5 ounce can The fat lends creaminess and helps carry the spices. Shake before opening to mix the cream and liquid.
  • Broth 3 cups Use vegetable broth or water with bouillon for a lighter pantry friendly option.
  • Lime juice of half a lime plus wedges for serving Bright acid at the end lifts the flavors and keeps the soup from tasting heavy.
  • Garnish sliced red onion cilantro roasted cashews and extra lime wedges These add crunch color and fresh brightness to finish the bowl.

Instructions

Warm the pan and sweat aromaticsWarm 2 tablespoons of oil over medium heat in a large soup pot or Dutch oven. Add the diced onion sliced garlic and 1 teaspoon of salt. Sauté for about 5 to 6 minutes stirring occasionally until the onion is translucent and soft. Look for glossy edges and a sweet aroma as visual cues to proceed.Bloom the spicesStir in 1 tablespoon of curry powder and a pinch of crushed dried chilies if using. Stir almost constantly for about 30 seconds until the spices become fragrant and start to cling lightly to the pan. This step wakes up the oils in the blend and deepens flavor.Add tomatoes and liquidPour in the 14.5 ounce can of diced tomatoes and 3 cups of broth. Use a wooden spoon to scrape any browned bits from the bottom of the pot. Bring the mixture to a boil then reduce to a gentle simmer.Simmer to soften tomatoesCover and cook for about 10 minutes until the tomatoes have softened and the broth has taken on color from the spices. This reduces raw tomato acidity and allows flavors to marry.Finish with chickpeas and coconut milkStir in the drained chickpeas and the entire 13.5 ounce can of full fat coconut milk. Bring the pot back up to a simmer and gently cook for about 5 more minutes so the flavors meld. Taste and adjust salt and pepper.Brighten and serveRemove from heat and stir in the juice of half a lime. Ladle into bowls and top with sliced red onion cilantro roasted cashews and extra lime wedges for squeezing. Serve hot and enjoy.User provided content image 1

You Must Know

  • This bowl is naturally high in plant protein from chickpeas and provides healthy fats from coconut milk making it a satisfying single pot option.
  • Leftovers store well in the refrigerator for up to four days and flavor improves as the spices rest.
  • The soup freezes well for up to three months. Thaw in the refrigerator overnight then reheat gently on the stove to avoid breaking the coconut fat.
  • Adjust salt at the end after the coconut milk joins the pot as fat can mute seasoning and you will likely need a touch more.

My favorite aspect is how versatile the bowl can be. On one occasion I served it at a casual dinner and a friend who avoids coconut was surprised by how subtle the coconut milk tasted because it primarily carries the spices. My family likes it with big wedges of lime and crunchy cashews which make it feel celebratory even on a weeknight. The method is forgiving so it works well for cooks at any skill level who want a reliable flavorful meal in minimal time.

Storage Tips

Cool the soup completely before storing to prevent condensation which can water down flavor. Transfer into airtight containers and refrigerate up to four days. For longer storage portion into freezer safe containers leaving an inch of headspace and freeze for up to three months. Reheat gently on medium low heat stirring occasionally to recombine the coconut cream with the broth. If the texture seems thicker than you prefer add a splash of hot broth or water as it reheats to reach the original consistency.

Ingredient Substitutions

If you do not have avocado oil use light tasting olive oil or sunflower oil. For coconut milk you can use light coconut milk for fewer calories though the texture will be less silky. Swap chickpeas for white beans or lentils if you prefer but expect differences in firmness and cooking time. If canned diced tomatoes are not available use two cups of crushed tomatoes and one cup water or broth. Adjust curry powder intensity by reducing the amount for a milder bowl or by adding a touch of garam masala at the end for a different warm note.

User provided content image 2

Serving Suggestions

Serve in deep bowls with a scattering of fresh cilantro thinly sliced red onion and roasted cashews for crunch. Offer lime wedges at the table for a bright finish. For heartier meals add a side of basmati rice or warm flatbread. For a lighter lunch serve with a simple cucumber salad dressed with rice vinegar and a touch of sugar to balance the soup warmth. Garnish with a drizzle of extra coconut milk for an elegant look.

Cultural Background

This bowl takes inspiration from South Asian curries where coconut and chickpea pairings are common in coastal regions. The method is simplified to suit quick modern kitchens while retaining aromatic steps of sweating aromatics and blooming spices. Tomato and coconut combinations appear in several regional dishes and here they are adapted into a soup format that highlights the comfort and approachability of curry flavors without a long list of spices.

Seasonal Adaptations

In summer swap the canned tomatoes for two cups of fresh chopped tomatoes and cook until they break down for a fresher bright profile. In winter add a cup of roasted winter squash or sweet potato for added body and seasonal sweetness. You can also fold in a handful of baby spinach at the end for color and extra nutrition which wilts quickly into the hot broth.

Meal Prep Tips

To meal prep make a double batch then portion into four to six containers for easy lunches. Store rice in separate containers to keep grains from getting soggy. Reheat in the microwave covered for two to three minutes stirring halfway or reheat on the stove with a splash of water until steaming. Pack garnishes separately so onions remain crisp and cashews stay crunchy until serving.

Make this bowl your own by adjusting spice heat and garnishes. It is a fast reliable dish that brings warmth and comfort in under thirty minutes. Enjoy the ease of a nourishing meal that feels like a hug in a bowl and share it with friends and family who will appreciate how simple and delicious plant based cooking can be.

Pro Tips

  • Toast the curry powder briefly in the pan to release oils for more depth.

  • Rinse canned chickpeas to remove excess sodium and canned flavor.

  • Use full fat coconut milk for creaminess, then adjust seasoning at the end.

  • Freeze in individual portions for quick ready to heat lunches.

  • Brighten each bowl with fresh lime juice just before serving.

This nourishing 30 minute chickpea and tomato coconut curry soup recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Soups and Stewsvegangluten-freesoupchickpeascoconut-milkcurryweeknight-dinnersvegetarianrecipes
No ratings yet

30 Minute Chickpea and Tomato Coconut Curry Soup

This 30 Minute Chickpea and Tomato Coconut Curry Soup recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
30 Minute Chickpea and Tomato Coconut Curry Soup
Prep:10 minutes
Cook:20 minutes
Rest Time:10 mins
Total:30 minutes

Ingredients

for soup

for garnish

Instructions

1

Warm the pan and sweat aromatics

Heat 2 tablespoons of oil in a large pot over medium heat. Add the diced onion sliced garlic and 1 teaspoon salt. Sauté for 5 to 6 minutes until the onion is translucent and soft

2

Bloom the spices

Add 1 tablespoon curry powder and a pinch of crushed chilies if using. Stir almost constantly for about 30 seconds until spices are fragrant and begin to cling to the pan

3

Add tomatoes and broth

Pour in the 14.5 ounce can of diced tomatoes and 3 cups of broth. Scrape up any browned bits and bring to a boil then reduce to a simmer

4

Simmer to soften tomatoes

Cover and cook for about 10 minutes until tomatoes are soft and the liquid has taken on flavorful color from the spices

5

Finish with chickpeas and coconut milk

Stir in drained chickpeas and the 13.5 ounce can of full fat coconut milk. Bring back to a gentle simmer and cook 5 more minutes to marry flavors

6

Brighten and serve

Remove from heat stir in juice of half a lime then season with salt and pepper to taste. Serve topped with sliced red onion cilantro roasted cashews and extra lime wedges

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 420kcal | Carbohydrates: 45g | Protein:
12g | Fat: 22g | Saturated Fat: 7g |
Polyunsaturated Fat: 4g | Monounsaturated Fat:
9g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@flavest on social media!

30 Minute Chickpea and Tomato Coconut Curry Soup

Categories:

30 Minute Chickpea and Tomato Coconut Curry Soup

Did You Make This?

Leave a comment & rating below or tag @flavest on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Maria!

Chef and recipe creator specializing in delicious Soups and Stews cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.